PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G17070.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 132aa    MW: 14376.1 Da    PI: 7.4069
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G17070.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB148.11.9e-461781794
            NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                     mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre +
  OMERI05G17070.4  1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREGD 78
                     9**************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.6E-43186IPR009072Histone-fold
SuperFamilySSF471132.01E-31180IPR009072Histone-fold
PfamPF008081.3E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.4E-231937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.4E-233856No hitNo description
PRINTSPR006156.4E-235775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EDYIEPLKVY LQKYREGDSK LTAKAGDGSV KKDVLGSHGG SSSSAQGMGQ QAAYNQGMGY  120
MQPQYHNGDV SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-401761893NF-YB
4awl_B1e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0954390.0AB095439.1 Oryza sativa Japonica Group OsHAP3B mRNA for HAP3, partial cds.
GenBankAK1008110.0AK100811.1 Oryza sativa Japonica Group cDNA clone:J023121O11, full insert sequence.
GenBankAY2245300.0AY224530.1 Oryza sativa (japonica cultivar-group) isolate 21744 CCAAT-binding transcription factor-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961814.13e-87PREDICTED: nuclear transcription factor Y subunit B
RefseqXP_004961815.13e-87PREDICTED: nuclear transcription factor Y subunit B
RefseqXP_012700237.13e-87PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252091e-87NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLA0A0E0DSM03e-95A0A0E0DSM0_9ORYZ; Uncharacterized protein
STRINGOB05G27050.13e-93(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.33e-54nuclear factor Y, subunit B8